powered by:
Protein Alignment Cpr76Bc and Cpr78Cb
DIOPT Version :9
Sequence 1: | NP_001097644.1 |
Gene: | Cpr76Bc / 40122 |
FlyBaseID: | FBgn0036880 |
Length: | 424 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001262144.1 |
Gene: | Cpr78Cb / 40353 |
FlyBaseID: | FBgn0037068 |
Length: | 140 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 18/71 - (25%) |
Similarity: | 28/71 - (39%) |
Gaps: | 16/71 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 41 DDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105
|||.: |.|..|..:..||::.....:..|: ||...|:|......|.|| :
Fly 50 DDEGV------------FKYAFKTSNGIDVQAAGSPLETIGI---YSYTSPEGVPIETRYIAD-E 98
Fly 106 KGFNAI 111
.||:.:
Fly 99 LGFHVV 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.