DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr78Cb

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001262144.1 Gene:Cpr78Cb / 40353 FlyBaseID:FBgn0037068 Length:140 Species:Drosophila melanogaster


Alignment Length:71 Identity:18/71 - (25%)
Similarity:28/71 - (39%) Gaps:16/71 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105
            |||.:            |.|..|..:..||::.....:..|:   ||...|:|......|.|| :
  Fly    50 DDEGV------------FKYAFKTSNGIDVQAAGSPLETIGI---YSYTSPEGVPIETRYIAD-E 98

  Fly   106 KGFNAI 111
            .||:.:
  Fly    99 LGFHVV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 13/51 (25%)
Cpr78CbNP_001262144.1 Chitin_bind_4 55..101 CDD:278791 13/49 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.