DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr76Ba

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster


Alignment Length:134 Identity:52/134 - (38%)
Similarity:64/134 - (47%) Gaps:28/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EDDETMEYAP-----------HYE----HQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVL 89
            :|....::||           |:|    |..|.|:|||||..|||:|.|||:||||.|||.|::.
  Fly    69 QDHHHQQWAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMK 133

  Fly    90 EPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIVLS 154
            |.||..|.|.||||:..||.|.||.||..||.             :.|.|....|.....|....
  Fly   134 EADGRTRIVEYTADSHNGFQATVKHVGHASHL-------------EHSHSYGQQYGHGHGHATSY 185

  Fly   155 SDIK 158
            .|:|
  Fly   186 VDVK 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 31/51 (61%)
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.