DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr72Eb

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648883.1 Gene:Cpr72Eb / 39815 FlyBaseID:FBgn0036618 Length:217 Species:Drosophila melanogaster


Alignment Length:292 Identity:68/292 - (23%)
Similarity:111/292 - (38%) Gaps:113/292 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LALICLGTRPPPIG-AVRGGSPVVVIDEDDETMEYAP----------HY--EHQGYAFSYGVKDL 65
            |.|||     ..|| ||  |||         |:||.|          |:  ||..||:.|     
  Fly     6 LCLIC-----TTIGLAV--GSP---------TLEYGPPPTSDTISQYHHQDEHGQYAYGY----- 49

  Fly    66 HTGDVKSQWESRDGDGV-KGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESP-EG 128
             ...:.|:.|:|..||| :|.:|.::.:|..:||.|.||| :||           |..:..| :.
  Fly    50 -MAPLYSKHETRTVDGVIRGTFSHIDANGETQTVDYVADA-EGF-----------HVTSNLPNQQ 101

  Fly   129 SNQVNDDTSQSKINHY-SKDQEHIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIKPHARIKQVPMD 192
            :||...:.:..:..|. :.:|..:.|:.|.....:|:.|.    |:|.:                
  Fly   102 ANQETPEVAALRTQHLEAHNQAKLRLAGDYSVGPQPVRDT----PEVAA---------------- 146

  Fly   193 MDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPTYAVQEGDWKAVIVNEPKE----------Y 247
                       |:..::|:..|        :||:.....::   |.:::..|..          |
  Fly   147 -----------AKVAFFKRFEA--------EKLRNKLLAEK---KVLVIPNPTPIAVRSQPIYVY 189

  Fly   248 RPHYTTGSPAHSHFYDHYKPK---EIP-HNYI 275
            :| .|||      |..:|..|   ::| .||:
  Fly   190 QP-TTTG------FVYNYHTKTQAQVPSRNYL 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 18/52 (35%)
Cpr72EbNP_648883.1 Chitin_bind_4 45..91 CDD:278791 18/52 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.