DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr72Ea

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648882.1 Gene:Cpr72Ea / 39814 FlyBaseID:FBgn0036617 Length:341 Species:Drosophila melanogaster


Alignment Length:277 Identity:59/277 - (21%)
Similarity:108/277 - (38%) Gaps:93/277 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 FSYGVKDLHTGDVKSQWESRDGDGV-KGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHP 121
            :|||    ::..:.|:.|:|..||: :|:||..:..|.::||:|.|| .|||:     |.|.:.|
  Fly    49 YSYG----YSEPLSSKQETRTLDGITQGYYSYRDAAGKLQTVNYVAD-NKGFH-----VAATNLP 103

  Fly   122 ITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIKPHARI 186
            ..:.|:.|.:.:..::...::|:.  :.|..:|..:  ::.|:    ..||     ||:..|   
  Fly   104 KAKVPQESLEFSPRSASHPVDHHV--EHHAEVSHAV--VQHPV----GHHP-----IEVPHH--- 152

  Fly   187 KQVPMDMDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPT--YAVQEGDWKAVIVNEPKEYRP 249
                                         |.:.:..:...|.  :.|:..:.:..:...|..:.|
  Fly   153 -----------------------------HTVVESGRSAHPDGHHPVEHHEHRVAVAQHPVGHHP 188

  Fly   250 -----HYT---TGSPAH---SHFYDHYK-------------PKEIPHNYIHKPSVPQQSLHTSFS 290
                 |:|   ||..||   .|..:|::             |.|:||:  |......:|.|.   
  Fly   189 VEVPHHHTVVETGRSAHPDGHHPVEHHEHPVAVAQHPVGNHPVEVPHH--HTVVESGRSAHP--- 248

  Fly   291 PSKPRINIPESISNHIH 307
                  .:|.||.:|.|
  Fly   249 ------EVPHSIEHHEH 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 18/50 (36%)
Cpr72EaNP_648882.1 Chitin_bind_4 49..95 CDD:278791 18/50 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.