DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr67B

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648306.1 Gene:Cpr67B / 39081 FlyBaseID:FBgn0035985 Length:260 Species:Drosophila melanogaster


Alignment Length:268 Identity:61/268 - (22%)
Similarity:92/268 - (34%) Gaps:117/268 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GTRPPPIGAVRGGSPVV---VIDEDDETMEYAPHYE-HQGYA------FSYGVKDLHTGDVKSQW 74
            |..|.|......|..|.   ||:..:|.:|  .||: ||.:.      |:||.:|.:.|    :.
  Fly    52 GENPLPEARNEKGEFVYMGRVIEHPEEYVE--EHYDAHQYHGQDGLGQFAYGYRDWNQG----KN 110

  Fly    75 ESRDGDG-VKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQ 138
            |.||..| |.|.|..::|.|.....:|.|| |.||:                             
  Fly   111 EKRDETGKVTGSYKYVQPHGRDFVANYYAD-KTGFH----------------------------- 145

  Fly   139 SKINHYSKDQEHIVLSSDIKPLKRPIEDLTHSHPKVPSLIEIKPHARIKQVPMDMDPGIRDRLQQ 203
                                     :||...:|.|:|:   .|..|.:|                
  Fly   146 -------------------------VEDNRPAHLKLPA---TKTPAVLK---------------- 166

  Fly   204 ARDTYYK---QIAAA--HKLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYTTGSPAHSHFYD 263
            |.:.::|   ::|||  |..:.|:.:.|     |||.::.   .|| ||:|            |.
  Fly   167 AEEEHFKLWGELAAAAGHNPDPYAAEYQ-----QEGRYQP---TEP-EYQP------------YV 210

  Fly   264 HYKPKEIP 271
            |.:|..:|
  Fly   211 HEEPPYVP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 18/58 (31%)
Cpr67BNP_648306.1 Chitin_bind_4 <111..144 CDD:278791 13/33 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.