DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CG13670

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648207.1 Gene:CG13670 / 38938 FlyBaseID:FBgn0035873 Length:266 Species:Drosophila melanogaster


Alignment Length:188 Identity:58/188 - (30%)
Similarity:81/188 - (43%) Gaps:54/188 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLALICLGTRPPPIGA--------VRGGSPVV-----VIDEDDETMEYAPHYEHQGYAFSYGVKD 64
            ||.|:.|......|||        .|...|||     |...|..|::|....|   |:|:|||:|
  Fly    50 LLPLLALIAGCGMIGACAAVGYSYARFEGPVVGPEHLVTVHDGRTVDYVARPE---YSFAYGVED 111

  Fly    65 LHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVG------------- 116
            ..|..::::.|:|:||.|:|.|||::|||::|.|.||||...||.|.|.|.|             
  Fly   112 GKTRVLQNRKETRNGDEVRGVYSVVDPDGTLRVVKYTADDANGFQAEVITNGVKTLHGHGSDGDA 176

  Fly   117 -------------ANSHPITESPE------------GSNQVNDDTSQSKINHYSKDQE 149
                         |.:|...|..|            |..||::|..:.|.....:|:|
  Fly   177 GGGSVDSQVRHHSAEAHKAKEDDEEEDEREREHQGNGQYQVHEDYDEGKDEQAEEDEE 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 25/51 (49%)
CG13670NP_648207.1 Chitin_bind_4 103..155 CDD:278791 25/51 (49%)
Paf1 <215..265 CDD:281915 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.