DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr65Ec

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_648077.1 Gene:Cpr65Ec / 38775 FlyBaseID:FBgn0035737 Length:127 Species:Drosophila melanogaster


Alignment Length:151 Identity:38/151 - (25%)
Similarity:60/151 - (39%) Gaps:48/151 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RFYITTHLPAILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQG-YAFSYGVKDL 65
            :|::   |....||:.|          |:..|    .|...||.||....:..| ||:.|...:.
  Fly     3 KFFV---LAVAALAVSC----------VQADS----FDARAETREYKSDLKEDGSYAYQYQTSNG 50

  Fly    66 HTGDVKSQWESRDGDGVKGHY-----SVLEPDGSIRTVHYTADAKKGFN--------------AI 111
            ..|.     ||    ||.|:|     :...|||.:..:.||||: .|::              :|
  Fly    51 IAGQ-----ES----GVGGYYASGSNAYYAPDGQLIQLTYTADS-NGYHPAGAHLPTPPPIPASI 105

  Fly   112 VKTVG-ANSHPITESPEGSNQ 131
            :|::. ..:||..||.:|..:
  Fly   106 LKSLEYIRTHPQQESRQGQGR 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 17/56 (30%)
Cpr65EcNP_648077.1 Chitin_bind_4 41..88 CDD:278791 17/56 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.