DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr56F

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster


Alignment Length:106 Identity:34/106 - (32%)
Similarity:48/106 - (45%) Gaps:9/106 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAK 105
            |:|  :|.|    ..|.|.|.|:|..:|:.....||||||...|.|.||.|||..:.|.|.|| :
  Fly   119 DEE--QYGP----AKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEAD-Q 176

  Fly   106 KGFNAIVK--TVGANSHPITESPEGSNQVNDDTSQSKINHY 144
            .|:...::  .||..:.....:.......:.:..|.|.|.|
  Fly   177 NGYRPTIRYEQVGNGNGNGNGNGRNGGGYDSNAQQGKFNGY 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 23/51 (45%)
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 23/51 (45%)

Return to query results.
Submit another query.