DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr49Ad

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610773.1 Gene:Cpr49Ad / 36349 FlyBaseID:FBgn0033726 Length:166 Species:Drosophila melanogaster


Alignment Length:100 Identity:24/100 - (24%)
Similarity:45/100 - (45%) Gaps:10/100 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 VIDEDDETMEYAPHYEHQGYAFSY----GVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRT 97
            :::::::.     :|....|:::|    |:.....|...:....:..:.|:|.||.:.|:|....
  Fly    69 IVEQNNDV-----NYGAGSYSYNYETENGIHGEERGVPVNIGNQQQEEQVEGAYSFITPEGLRVG 128

  Fly    98 VHYTADAKKGFNAIVKTVGANSHPITESPEGSNQV 132
            |.|.||| .||..::...|.||......|..:|.|
  Fly   129 VKYLADA-NGFRPVITYDGVNSAFYAGQPAPANVV 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 15/55 (27%)
Cpr49AdNP_610773.1 Chitin_bind_4 83..138 CDD:278791 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.