DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr47Ef

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:130 Identity:36/130 - (27%)
Similarity:52/130 - (40%) Gaps:35/130 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 RPPPIGAV--RGGSPVVV---IDEDDETMEYAPHYEHQGYAFSY----GVKDLHTGDVKSQWESR 77
            ||.|.|..  ..|.|:.:   ::|:|         ....|.|||    |:|....|.||::....
  Fly   119 RPSPSGGAPPTSGPPIPILSFVNEND---------GDGNYRFSYETGNGIKAQEEGTVKNKGSEN 174

  Fly    78 DGDGVKGHYSVLEPDGSIRTVHYTADAKKGF--------------NAIVKTVGANSHPITESPEG 128
            :...|.|.||...|:|.:..:.|||| :.||              .||.|::.|..  |:..|.|
  Fly   175 EIPSVMGSYSYTNPEGELVEIMYTAD-ENGFVPSGNALPTPPPIPEAIAKSLAAQG--ISILPGG 236

  Fly   129  128
              Fly   237  236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 19/55 (35%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:278791 19/55 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.