DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Cpr47Ec

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_610657.1 Gene:Cpr47Ec / 36191 FlyBaseID:FBgn0033600 Length:131 Species:Drosophila melanogaster


Alignment Length:104 Identity:26/104 - (25%)
Similarity:41/104 - (39%) Gaps:14/104 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LPAILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQGYAFSY----GVKDLHTGD 69
            ||..:||::....:..|:...|  .||.::..:....|       :||..:|    |:.......
  Fly     5 LPLFVLAVMVACGQALPVDPER--EPVAILKSEIIKTE-------EGYTSAYVGADGISRNEEAF 60

  Fly    70 VKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGF 108
            :..:....:...|||.|..:..||....|.||| .|.||
  Fly    61 LVDKGTDEEALEVKGSYKYINEDGQEVEVFYTA-GKNGF 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 14/55 (25%)
Cpr47EcNP_610657.1 Chitin_bind_4 43..98 CDD:278791 14/55 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.