DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and Crys

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_001285854.1 Gene:Crys / 34604 FlyBaseID:FBgn0005664 Length:477 Species:Drosophila melanogaster


Alignment Length:201 Identity:60/201 - (29%)
Similarity:94/201 - (46%) Gaps:46/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DEDDETMEYAPH----YE-HQGYAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTV 98
            ::||:....||:    |: ...|:|:|.|:|..|||.|.|.|.||||.|||.||::||||:.|.|
  Fly    55 NDDDDATTLAPNSNEDYDTRPQYSFAYDVRDSLTGDDKRQEEKRDGDLVKGQYSLIEPDGTRRIV 119

  Fly    99 HYTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIKPLKRP 163
            .||||...||||||                |.|..|:..|.:            ||:........
  Fly   120 EYTADDVSGFNAIV----------------SKQRLDEQQQQR------------LSASTSSRFNS 156

  Fly   164 IEDL-----THSHPKVPSLIEIKPHARIK---QVPMDMDPGIRDRLQQARDTYYKQIAAAHKLED 220
            :|:|     ..:..:..||:|.:..::::   |...:.:...|::.||..:.:.:|:.     :.
  Fly   157 LEELQTRLTAQAIAEAQSLVEAQQASQLQLEAQNRRESENQARNQAQQLMEQFQQQVQ-----QQ 216

  Fly   221 YSQKLQ 226
            ..|:||
  Fly   217 EQQRLQ 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 30/51 (59%)
CrysNP_001285854.1 Chitin_bind_4 77..129 CDD:278791 30/51 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.