DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CPR68

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_565358.3 Gene:CPR68 / 3290246 VectorBaseID:AGAP006838 Length:138 Species:Anopheles gambiae


Alignment Length:136 Identity:40/136 - (29%)
Similarity:55/136 - (40%) Gaps:37/136 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 YITTHLPAILLALICLGTRPPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQG---YAFSYGVKDL 65
            ::..||.|:|.|                         .|..:|:..:|:...   |:|.|.:...
Mosquito    11 WLVAHLCALLTA-------------------------GDHLVEFVSNYQQNAEIDYSFRYYIDHP 50

  Fly    66 HTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSHPITESPEGSN 130
            .:|.....||:|.||.|.|.|.||||.|.:|||||..|...||..::||.         :|..|.
Mosquito    51 PSGVSFDHWENRKGDHVHGGYGVLEPGGFVRTVHYEVDGDSGFRTVIKTT---------APGSSQ 106

  Fly   131 QVNDDT 136
            |.|..|
Mosquito   107 QYNIHT 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 23/51 (45%)
CPR68XP_565358.3 Chitin_bind_4 41..93 CDD:278791 23/51 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.