DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CG32603

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:NP_727758.1 Gene:CG32603 / 318109 FlyBaseID:FBgn0052603 Length:345 Species:Drosophila melanogaster


Alignment Length:248 Identity:54/248 - (21%)
Similarity:80/248 - (32%) Gaps:73/248 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 YTADAKKGFNAIVKTVGANSHPITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIKPLKRPI 164
            |||.      |:|||..|.:.....:|..|......|:.:.:..||        :..:.....|:
  Fly   137 YTAP------AVVKTYSAPAVSTYSAPAVSGYSQTYTAPAVVKTYS--------APAVSTYTAPV 187

  Fly   165 EDLTHSHPKVPSLIEIKPHARIKQVPMDMDPGIRDRLQQARDTY-----YKQIAAAHKLEDYSQK 224
            ...|::.|.|         |:....|             |..||     .|...|...::.||..
  Fly   188 VTKTYTAPVV---------AKTYTAP-------------AVSTYTAPVVAKTYTAPAVVKTYSAP 230

  Fly   225 LQPTY-AVQEGDWKAVIVNEPKEYRPHYTTGSPAHSHFYDHYKPKEIPHNYIHKPSVPQQSLHTS 288
            ...|| |.....:.|.:|.  |.|.....|.:         |....:...|    |.|..|.:| 
  Fly   231 AVSTYSAPAVSTYTAPVVT--KTYTAPVVTKT---------YTAPAVVKTY----SAPAVSTYT- 279

  Fly   289 FSPSKPRINIPESISNHIHQKKVV---HTTPGLKHYKYKGVSKSYSRPDYSSY 338
             :|:......|           ||   ::.|.:..|....|:|:||.|..|||
  Fly   280 -APAVSTYTAP-----------VVAKTYSAPAVSTYTAPVVTKTYSAPAVSSY 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 3/7 (43%)
CG32603NP_727758.1 PRK07003 <29..>186 CDD:235906 13/62 (21%)
rne <109..299 CDD:236766 44/225 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.