DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CPR83

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_319252.2 Gene:CPR83 / 1279524 VectorBaseID:AGAP010098 Length:159 Species:Anopheles gambiae


Alignment Length:70 Identity:35/70 - (50%)
Similarity:45/70 - (64%) Gaps:0/70 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 YAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIVKTVGANSH 120
            |.|||.|.|.||||:|||.|.|.||.|||.|::::.||..|.|.||||...||||:|:......|
Mosquito    35 YQFSYSVHDDHTGDIKSQQEERHGDDVKGQYTLIDADGHRRVVDYTADEHNGFNAVVRREPLEGH 99

  Fly   121 PITES 125
            .:.::
Mosquito   100 KLVKT 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 29/51 (57%)
CPR83XP_319252.2 Chitin_bind_4 35..87 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.