DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CPR74

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_318987.4 Gene:CPR74 / 1279288 VectorBaseID:AGAP009869 Length:122 Species:Anopheles gambiae


Alignment Length:117 Identity:32/117 - (27%)
Similarity:46/117 - (39%) Gaps:32/117 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLALICLGTRPPPIGAVRGGSPVVVIDED------DETMEYAPHYEHQGYAF--SYGVKDLHTGD 69
            ||||:.|      :.|....:||   |.|      .:|.:..|.... .|||  :.|:|....|.
Mosquito     4 LLALVVL------MAATVYAAPV---DSDAQAQIVSQTSDVQPDGSF-NYAFESANGIKVEDQGS 58

  Fly    70 VKS-QWESRDGDGVK------------GHYSVLEPDGSIRTVHYTADAKKGF 108
            :|| :....|..|.:            |.:....|||.:.|:.|.|| :.||
Mosquito    59 IKSIKVPKLDETGRQIGEEDVQVSVQTGSFQYTAPDGQVYTLRYIAD-ENGF 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 18/66 (27%)
CPR74XP_318987.4 Chitin_bind_4 41..109 CDD:278791 18/69 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.