DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and LOC1272762

DIOPT Version :10

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_311670.4 Gene:LOC1272762 / 1272762 VectorBaseID:AGAMI1_005929 Length:138 Species:Anopheles gambiae


Alignment Length:107 Identity:45/107 - (42%)
Similarity:58/107 - (54%) Gaps:13/107 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 AILLALICLGTR-----PPPIGAVRGGSPVVVIDEDDETMEYAPHYEHQGYAFSYGVKDLHTGDV 70
            |:|.|.:...:.     |.|.||....:.|..     ...:|.|:.:   |::||.|.|..|||.
Mosquito     6 AVLAAFVATASAVAIGYPAPYGAYPAVAKVAA-----PLADYDPNPQ---YSYSYAVSDALTGDN 62

  Fly    71 KSQWESRDGDGVKGHYSVLEPDGSIRTVHYTADAKKGFNAIV 112
            |||.|||.||.|.|.||::||||:.|.|.||||...||||:|
Mosquito    63 KSQQESRSGDVVSGSYSLIEPDGTQRVVEYTADPVNGFNAVV 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:459790 30/51 (59%)
LOC1272762XP_311670.4 Chitin_bind_4 48..100 CDD:459790 30/51 (59%)

Return to query results.
Submit another query.