DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CPR143

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_311430.4 Gene:CPR143 / 1272517 VectorBaseID:AGAP010717 Length:492 Species:Anopheles gambiae


Alignment Length:397 Identity:82/397 - (20%)
Similarity:129/397 - (32%) Gaps:121/397 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 EDDETMEYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDG-VKGHYSVLEPDGSIRTVHYTAD 103
            ||.:::..|.....:.|.|||.|||..:||..|..:.:..|| |||.|.|..|||.::.|.|.||
Mosquito   138 EDIDSLNEAATDVKKNYVFSYAVKDTASGDDFSHTQQQHQDGAVKGSYKVHLPDGRMQIVKYIAD 202

  Fly   104 AKKGFNA---------------IVKTVGANSHPITESPEG------------SNQVNDDTSQSKI 141
             ..|:.|               .|.:..|.:.....:|.|            |..| ....|..|
Mosquito   203 -NNGYRADVTYENEPAGVVPASAVASAAATAQAAPVAPTGPVSPIAYQRYYASTPV-QQPQQQYI 265

  Fly   142 NH-------YSKDQEHIVLSSDIKPLK-RPIEDLTHSHPKVPSLIEIKPHARIKQVPMDMDPGIR 198
            .|       |...|....:.:...|.: ||.:...||:...|....:......:..|:       
Mosquito   266 THQIRPARLYYAAQNPTQIPAPFYPSQLRPSDVKIHSYNTAPHAGAVIASTTTQATPV------- 323

  Fly   199 DRLQQARDTYYKQIAAAHKLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYT----------- 252
                  ...|.....||..|                   |.|...|....|..|           
Mosquito   324 ------AGAYLAAFPAAGNL-------------------AYIATAPVNGGPIRTLQLQSNGGGAA 363

  Fly   253 -------TGSPAHSHFYDHYKPKEIPHNYIHKPSVPQQSLHTSFSPSKPRINI--------PE-- 300
                   |..|..:     |:...:|      ||.|.|.|..:|:.:..|..:        |:  
Mosquito   364 GTIAVPVTAIPLAA-----YRDINVP------PSPPVQPLGVAFASAGRRTTVYADQARVSPQGS 417

  Fly   301 -SISNHIHQKKVVHTT---PGLKHYKYKGV---SKSYSR-PDYSSYF---HRKPKKLRPQHPKQK 354
             ::...|:|::....:   |....|.|..:   ::.|.| .|:::..   .:.||.: .|.|:.:
Mosquito   418 GTLQQVIYQQQQQQQSQQQPQSLDYGYVQIPVDNRVYKRNTDHNTEVMAGSKAPKNV-AQKPRNQ 481

  Fly   355 PRAHRPE 361
            .:.|:.|
Mosquito   482 TKRHQQE 488

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 24/52 (46%)
CPR143XP_311430.4 Chitin_bind_4 154..206 CDD:278791 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.