DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CPR130

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_311111.4 Gene:CPR130 / 1272228 VectorBaseID:AGAP000047 Length:354 Species:Anopheles gambiae


Alignment Length:436 Identity:88/436 - (20%)
Similarity:138/436 - (31%) Gaps:182/436 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 EYAPHYEHQGYAFSYGVKDLHTGDVKSQWESRDGDGV-KGHYSVLEPDGSIRTVHYTADAKKGF- 108
            :|..|....||::.|...:      ..:.|::|..|: .|.||.::.:|.:::|.||||...|| 
Mosquito    30 QYQAHDGIGGYSYGYAEPN------SQKHETKDAHGITHGGYSYVDANGHVQSVKYTADPIHGFQ 88

  Fly   109 --------------------NAIV---KTVGANSHPITESPEGSNQVNDDTSQSKINHY-----S 145
                                ||..   ..:|.|..|: |:||        ...:|..|:     :
Mosquito    89 VSGTNLPKGPAPHAVPVPAWNAYAYAPVVLGHNGAPL-ETPE--------VQAAKAAHFAAHAAA 144

  Fly   146 KDQEH---------------IVLSSDIKPLKRPIEDLTH-------SHPKVPSLIEIKPHARIKQ 188
            |.:.|               :||..:..||..|  ::.|       :|.|...      ||....
Mosquito   145 KARLHKRSLYAPWTYAAAAPVVLGHNGVPLDTP--EVAHAKAEHAAAHAKALG------HAYAPA 201

  Fly   189 VPMDMDPGIRDRLQQARDTYYKQIAAAHKLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYTT 253
            .|:...|    .:|.|:..:....|||                                |.::..
Mosquito   202 GPVPDTP----EVQHAKAAHLAAHAAA--------------------------------RANHHA 230

  Fly   254 GSP----AHSHFYDH--YKPKEIPHNYIHKPSVPQQSLHTSFSPSKPRINIPESISNHIHQKKVV 312
            .:|    ||:|...|  :.|:.:|   :.|..||.:                             
Mosquito   231 VAPVTTVAHTHHAVHAAHYPQHVP---VIKNGVPVE----------------------------- 263

  Fly   313 HTTPGLKHYK---YKGVSKS--YSRPDYSSYFHRKPKKLRPQHPKQKPRAHRPENSGPVLFPKSL 372
              ||.::|.|   :..|:|:  |:.....||:        |||   .|..|   |..||..|:  
Mosquito   264 --TPEVQHAKAAHFAAVAKAQGYAPAHAHSYY--------PQH---IPVIH---NGVPVETPE-- 310

  Fly   373 EDEFEDFEEDEQGAASATLVQNMVRKDKKHMVPMYAGGHSFDSGSY 418
                   .:..:.|..|.|.:...|..  |.......||. |.|||
Mosquito   311 -------VQHAKAAHYAALAEASARAG--HGASWAPAGHE-DDGSY 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 14/52 (27%)
CPR130XP_311111.4 Chitin_bind_4 40..87 CDD:278791 14/52 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.