DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CPR152

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_024667073.1 Gene:CPR152 / 1270916 VectorBaseID:AGAP012487 Length:317 Species:Anopheles gambiae


Alignment Length:286 Identity:66/286 - (23%)
Similarity:99/286 - (34%) Gaps:75/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 DEDDETMEYAPHYEHQG--------YAFSYGVKDLHTGDVKSQWESRDGDGVKGHYSVLEPDGSI 95
            ||.::..::..:::..|        |.|||.|.:.||.......|.||||...|.|:||.|||..
Mosquito    86 DEHEDHHDHHDNHDESGSFEDEPAKYEFSYEVDEEHTDLSFGHEEMRDGDYTTGKYNVLLPDGRR 150

  Fly    96 RTVHYTADAKKGFNAIVKTVGANSHP-ITESPEGSNQVNDDTSQSKINHYSKDQEHIVLSSDIKP 159
            :.|.|.|| .||:...:...|.:.|| ..|.|      ::...:.....|||:..|       ..
Mosquito   151 QIVEYEAD-HKGYRPKITYEGGDEHPHHHEHP------HEHAQEHGHGGYSKEAPH-------NQ 201

  Fly   160 LKRPIED--------LTHSHPKVPSLIEIKPHARIKQVPMDMDPGIRDRLQQARDTYYKQIAAAH 216
            |..|.|.        :||...:..|......|:|       .|.||.|               :|
Mosquito   202 LGYPRESHHDFEHNGITHGSNEYDSHGHDNGHSR-------ADHGIHD---------------SH 244

  Fly   217 KLEDYSQKLQPTYAVQEGDWKAVIVNEPKEYRPHYTTGSPAHSHFYDHYKPKEIPHNYIHKPSVP 281
            :  .|.......:..:.|:             .|..:|...:|....|.......||..|:    
Mosquito   245 R--GYDSNAHEYHGNKHGN-------------GHSNSGHNKNSAQNGHNDHHHNGHNGHHR---- 290

  Fly   282 QQSLHTSFSPSKPRINIPESISNHIH 307
               ..::.:.|..|:...:||.||.|
Mosquito   291 ---RRSNNNDSHHRLLNYQSIDNHHH 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 24/51 (47%)
CPR152XP_024667073.1 Chitin_bind_4 111..162 CDD:306811 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.