DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bc and CPR111

DIOPT Version :9

Sequence 1:NP_001097644.1 Gene:Cpr76Bc / 40122 FlyBaseID:FBgn0036880 Length:424 Species:Drosophila melanogaster
Sequence 2:XP_308831.4 Gene:CPR111 / 1270156 VectorBaseID:AGAP006931 Length:325 Species:Anopheles gambiae


Alignment Length:286 Identity:63/286 - (22%)
Similarity:99/286 - (34%) Gaps:111/286 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 HLPAILLALICLGTRPPPIGAVRGGSPVVVIDE---DDETMEYAPHYEHQGYAFSYGVKDLHTGD 69
            |.||:..|...|.    |...:....|..:..:   .||..:|           |||    :.|.
Mosquito    28 HQPALYAAAAPLA----PATYIAAAGPAELHSQYHAQDELGQY-----------SYG----YNGG 73

  Fly    70 VKSQWESRDGDGV-KGHYSVLEPDGSIRTVHYTADAKKGFN--------AIVKTVGANSHPITES 125
            :.::.||:..||: :|.||.|:.:..::||.|||||..||.        |.|:|..| ..|:.::
Mosquito    74 LSAKAESKSFDGITRGSYSYLDAENKLQTVAYTADALNGFRVAASNLPVAPVETRTA-PEPVQDT 137

  Fly   126 PEGSNQVNDDTS---QSKINHYSKDQEH----------------IVLSSDIKPLKRPIEDL---- 167
            ||.:....|..:   ::|:.:.:.::|.                .::::...|...|...|    
Mosquito   138 PEVAAAKADHMAAIEEAKLRNAAAEKEDAAAAAAAADAAAADSTAIIAAAPAPAAAPALPLPVAT 202

  Fly   168 ------------THSHPK---------VPSLIEIKPHARIKQVPMDMDPGIRDRLQQARDTY--- 208
                        |||..:         .|:.||:|..|..                 |..||   
Mosquito   203 YAAAAPASFAYSTHSIAQPIASYATYAAPAAIELKAPASF-----------------AYSTYTAA 250

  Fly   209 ----YKQIAAAHKLEDYSQKLQPTYA 230
                |.|.|||           |.||
Mosquito   251 APLAYAQYAAA-----------PAYA 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BcNP_001097644.1 Chitin_bind_4 56..108 CDD:278791 19/52 (37%)
CPR111XP_308831.4 Chitin_bind_4 66..113 CDD:278791 20/61 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.