DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Lcp65Ag3

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:56 Identity:20/56 - (35%)
Similarity:20/56 - (35%) Gaps:19/56 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KSQWETRDGD------------------KVKGSYSLKESDGTTRVVEYTADDHNGF 138
            |..|||.||.                  .|.|||.....||.|..|.|.| |.|||
  Fly    38 KYDWETSDGQAAQAVGQLNDIGTENEAISVSGSYRFIADDGQTYQVNYIA-DKNGF 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 18/54 (33%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:459790 18/54 (33%)

Return to query results.
Submit another query.