DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr65Ax1

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster


Alignment Length:74 Identity:20/74 - (27%)
Similarity:28/74 - (37%) Gaps:12/74 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 SVGHSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVE 129
            :||...|.|..:..:           |...:..|..|:.....:.....||:|....||.|..|.
  Fly    28 NVGIDNYSYAVETSD-----------GTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTVT 81

  Fly   130 YTADDHNGF 138
            |.||: |||
  Fly    82 YVADE-NGF 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 14/51 (27%)
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:459790 16/66 (24%)

Return to query results.
Submit another query.