DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and CG34462

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_001097548.1 Gene:CG34462 / 5740319 FlyBaseID:FBgn0085491 Length:312 Species:Drosophila melanogaster


Alignment Length:71 Identity:22/71 - (30%)
Similarity:36/71 - (50%) Gaps:3/71 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETR--DGDKVKGSYSLKESDGTTRVVEYTADDHNG 137
            |..|||:....|.|.|.:.|..|.:.:.:.|.|  :| .::|||.....||...|.:|.|.:..|
  Fly    51 YFVHEPYGPNTYSFGYEINDPQTQNSQFREEKRFVNG-SIQGSYGYARPDGRIEVTKYMAKEDGG 114

  Fly   138 FNAVVK 143
            ::|.::
  Fly   115 YSAQIQ 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 16/53 (30%)
CG34462NP_001097548.1 Chitin_bind_4 62..113 CDD:459790 16/51 (31%)

Return to query results.
Submit another query.