DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and LOC4578438

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_001238117.2 Gene:LOC4578438 / 4578438 VectorBaseID:AGAMI1_006281 Length:135 Species:Anopheles gambiae


Alignment Length:60 Identity:39/60 - (65%)
Similarity:47/60 - (78%) Gaps:0/60 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 KYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVKK 144
            :|||:|.|.|.||||.|||.|.|.||.|.|.|:|.::||..||||||||:||||||||::
Mosquito    35 EYQFEYSVHDDHTGDIKSQHEERHGDNVVGQYTLIDADGYRRVVEYTADEHNGFNAVVRR 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 33/51 (65%)
LOC4578438XP_001238117.2 None

Return to query results.
Submit another query.