DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and LOC4578367

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_001238133.1 Gene:LOC4578367 / 4578367 VectorBaseID:AGAMI1_005911 Length:187 Species:Anopheles gambiae


Alignment Length:69 Identity:43/69 - (62%)
Similarity:49/69 - (71%) Gaps:1/69 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KH-EPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNA 140
            || :..|..:|.|.|||.|.||||.|.|.|:|.||:|.|.|||.:|||..|.|||||||||||||
Mosquito    64 KHIDEDHDAQYDFSYGVHDDHTGDIKEQRESRHGDQVHGQYSLIDSDGHKRTVEYTADDHNGFNA 128

  Fly   141 VVKK 144
            ||.:
Mosquito   129 VVHR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 34/51 (67%)
LOC4578367XP_001238133.1 Chitin_bind_4 74..126 CDD:459790 34/51 (67%)

Return to query results.
Submit another query.