DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Lcp65Ae

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:65 Identity:20/65 - (30%)
Similarity:26/65 - (40%) Gaps:21/65 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 DAHTGDQKSQW--ETRDGD------------------KVKGSYSLKESDGTTRVVEYTADDHNGF 138
            ::..|.:..||  ||.||.                  .|:||:.....||.|..|.|.||: |||
  Fly    25 ESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQGSFRFVADDGQTYEVNYIADE-NGF 88

  Fly   139  138
              Fly    89  88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 18/63 (29%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:459790 17/55 (31%)

Return to query results.
Submit another query.