DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Lcp65Af

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_477274.1 Gene:Lcp65Af / 45017 FlyBaseID:FBgn0020639 Length:100 Species:Drosophila melanogaster


Alignment Length:73 Identity:22/73 - (30%)
Similarity:31/73 - (42%) Gaps:12/73 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VGHSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEY 130
            ||...:.|||:..:           |......|..|:.....:...|||:||....||.|..:.|
  Fly    27 VGPVSFNYGYETSD-----------GSSAQAAGQLKNVGTDEEALNVKGTYSFVADDGQTYSIAY 80

  Fly   131 TADDHNGF 138
            |||: ||:
  Fly    81 TADE-NGY 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 16/51 (31%)
Lcp65AfNP_477274.1 Chitin_bind_4 32..87 CDD:459790 19/66 (29%)

Return to query results.
Submit another query.