Sequence 1: | NP_649121.1 | Gene: | Cpr76Bb / 40121 | FlyBaseID: | FBgn0036879 | Length: | 198 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_650905.2 | Gene: | Cpr92F / 42450 | FlyBaseID: | FBgn0038819 | Length: | 381 | Species: | Drosophila melanogaster |
Alignment Length: | 231 | Identity: | 57/231 - (24%) |
---|---|---|---|
Similarity: | 71/231 - (30%) | Gaps: | 109/231 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 FF---ALL---VGASWAAPHGGHATSYSSVTKHEGPVHKSLGYGYDHDVVSAYGGIYGHGYPSVG 67
Fly 68 HSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTA 132
Fly 133 DDHNGFNAVVKKLGHAHHPQVY-------------HKGYGHGDIY-------------------D 165
Fly 166 ADYGYGHDVAQY--------------GGYGYGHGGH 187 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr76Bb | NP_649121.1 | Chitin_bind_4 | 86..138 | CDD:278791 | 16/51 (31%) |
Cpr92F | NP_650905.2 | Chitin_bind_4 | 37..84 | CDD:278791 | 20/66 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | P | PTHR12236 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.010 |