DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:66 Identity:35/66 - (53%)
Similarity:45/66 - (68%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVK 143
            :||  |:|.:.|.|:|..:||.|...|.||||.|:|.|||.::||..|.|.||||..|||||||:
  Fly    46 DPH--PQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVVR 108

  Fly   144 K 144
            :
  Fly   109 R 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 26/51 (51%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 26/51 (51%)

Return to query results.
Submit another query.