DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Ccp84Af

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_649678.1 Gene:Ccp84Af / 40820 FlyBaseID:FBgn0004778 Length:151 Species:Drosophila melanogaster


Alignment Length:98 Identity:44/98 - (44%)
Similarity:59/98 - (60%) Gaps:19/98 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNA 140
            ::::||  |:|:|.|.|:|:.:||.|||.|.||||.|.|.|||.:|||..|:|:||:|..|||||
  Fly    54 EEYDPH--PQYKFAYDVQDSLSGDSKSQVEERDGDVVHGEYSLIDSDGYKRIVQYTSDPVNGFNA 116

  Fly   141 VVKK--LGH---------------AHHPQVYHK 156
            ||.:  |.|               |..|..||:
  Fly   117 VVNRVPLDHVKTVVKTVAPVAVAAAPIPVAYHQ 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 29/51 (57%)
Ccp84AfNP_649678.1 Chitin_bind_4 62..114 CDD:459790 29/51 (57%)

Return to query results.
Submit another query.