DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr67Fb

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_648420.1 Gene:Cpr67Fb / 39225 FlyBaseID:FBgn0036110 Length:122 Species:Drosophila melanogaster


Alignment Length:66 Identity:20/66 - (30%)
Similarity:28/66 - (42%) Gaps:10/66 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVKKLGHAHH 150
            |.::||..:.....:...    .|.:..||.|....|||...:|||||: ||:...     .||.
  Fly    39 YSWEYGTSNGIDAQESGV----GGVQAAGSVSYAAPDGTPIQLEYTADE-NGYRPT-----GAHL 93

  Fly   151 P 151
            |
  Fly    94 P 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 16/51 (31%)
Cpr67FbNP_648420.1 Chitin_bind_4 39..86 CDD:459790 16/51 (31%)

Return to query results.
Submit another query.