DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr66D

DIOPT Version :9

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_729400.1 Gene:Cpr66D / 38990 FlyBaseID:FBgn0052029 Length:270 Species:Drosophila melanogaster


Alignment Length:133 Identity:43/133 - (32%)
Similarity:58/133 - (43%) Gaps:20/133 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 YPSVGHSGYGYGYDK------HEPHHY----PKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYS 117
            |.:...|..|.|..|      :|...|    ..|||.:.|||....:.:::.|.|||..:|||||
  Fly   125 YQAPSTSILGKGQHKLSLQQQNEEEEYDDQNSSYQFGFDVKDDEFTNYQNRKEIRDGSVIKGSYS 189

  Fly   118 LKESDGTTRVVEYTADDHNGFNA--------VVKKLGHAHHPQVYHKGYGHGDIYDADYGYGHDV 174
            :.:|||..|.|:||||...||.|        :|.|:.....|....:..||.  ...:|..|...
  Fly   190 VVDSDGFIRTVKYTADPKEGFKAEVIREPTDIVVKIPTPPPPTQLLRAGGHK--AQQEYSSGPSK 252

  Fly   175 AQY 177
            .||
  Fly   253 QQY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 24/51 (47%)
Cpr66DNP_729400.1 Chitin_bind_4 158..210 CDD:278791 24/51 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.