DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr65Aw

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_729147.1 Gene:Cpr65Aw / 38706 FlyBaseID:FBgn0052404 Length:117 Species:Drosophila melanogaster


Alignment Length:148 Identity:28/148 - (18%)
Similarity:51/148 - (34%) Gaps:45/148 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LFFALLVGASWAAPHGGHATSYSSVTKHEGPVHKSLGYGYDHDVVSAYGGIYGHGYPSVGHSGYG 72
            |.|.|::.:..|.  ..:||..:.:.:            ||::              ::...||.
  Fly     6 LLFGLILVSFCAC--SSNATDTAQILR------------YDNE--------------NMDSDGYA 42

  Fly    73 YGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNG 137
            :.::..:           |:........|:.....:...::||......||....:.|.||: ||
  Fly    43 FSFETSD-----------GISREERATLKNPGTPEEAIAIQGSVHWVGPDGIHYKLNYLADE-NG 95

  Fly   138 FNAVVKKLGHAHHPQVYH 155
            |.|..:     |.|||.|
  Fly    96 FQAQGE-----HLPQVEH 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 10/51 (20%)
Cpr65AwNP_729147.1 Chitin_bind_4 41..96 CDD:459790 11/66 (17%)

Return to query results.
Submit another query.