DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr64Ac

DIOPT Version :9

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_647874.1 Gene:Cpr64Ac / 38510 FlyBaseID:FBgn0035512 Length:188 Species:Drosophila melanogaster


Alignment Length:139 Identity:56/139 - (40%)
Similarity:68/139 - (48%) Gaps:19/139 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GASWAAPH--GGHATSYSSVTKHEGPV--HKSLGYGYDHDVVSAYGGIYGHGYP-SVGHSGYGYG 74
            |.::|||.  ...|.||::......|.  :.:....|...|::|         | :|........
  Fly    30 GLTYAAPKLLAAPAISYAAPKLLAAPAISYAAPAISYAPKVLAA---------PVAVAKVAVAEP 85

  Fly    75 YDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFN 139
            ||.:     |:|.|.|||.|.||||.|.|.||.....|.|||||.|.|||.|.|.||||..||||
  Fly    86 YDPN-----PQYSFSYGVTDHHTGDSKQQEETLVNGVVHGSYSLAEPDGTIRKVTYTADKVNGFN 145

  Fly   140 AVVKKLGHA 148
            |||:|.|.|
  Fly   146 AVVEKKGVA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 31/51 (61%)
Cpr64AcNP_647874.1 Chitin_bind_4 92..144 CDD:395303 31/51 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.