DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr64Ab

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_647873.2 Gene:Cpr64Ab / 38509 FlyBaseID:FBgn0035511 Length:120 Species:Drosophila melanogaster


Alignment Length:66 Identity:41/66 - (62%)
Similarity:50/66 - (75%) Gaps:2/66 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 EPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVK 143
            :||  |:|.|.|.|:||.|||.|||.|.||||.||||||:.::||:.|.|.||||..|||||||:
  Fly    37 DPH--PQYAFAYNVQDALTGDSKSQQEVRDGDVVKGSYSVVDADGSLRTVFYTADPINGFNAVVQ 99

  Fly   144 K 144
            :
  Fly   100 R 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 32/51 (63%)
Cpr64AbNP_647873.2 Chitin_bind_4 42..94 CDD:459790 32/51 (63%)

Return to query results.
Submit another query.