DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr50Ca

DIOPT Version :9

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:157 Identity:44/157 - (28%)
Similarity:61/157 - (38%) Gaps:29/157 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HG-GHATSYSSVTKHEGPV--------HKSLGYGYDHDVV----------SAYGGIYGHGYPSVG 67
            || |.:..|..||..|.||        |.::.....|.|:          ..:.|:.....|:..
  Fly   660 HGHGLSNGYEGVTNAEEPVTTVEHVVHHPTVATQLHHQVLLPKQQHHHHQQQHHGLVATVLPAEL 724

  Fly    68 HSGYGYG--------YDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKV-KGSYSLKESDG 123
            .|..|..        .||....:..||:|.|.::|.|||:.....:.||...| :|.|.:...||
  Fly   725 DSDKGVNGLHFVNSDEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDG 789

  Fly   124 TTRVVEYTADDHNGFNAVVKKLGHAHH 150
            ..:.|.|.||| .||:|.|...|...|
  Fly   790 RIQNVIYHADD-TGFHADVSFEGATKH 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 19/52 (37%)
Cpr50CaNP_610899.1 Chitin_bind_4 751..803 CDD:278791 19/52 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.