DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr50Ca

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_610899.1 Gene:Cpr50Ca / 36523 FlyBaseID:FBgn0033867 Length:815 Species:Drosophila melanogaster


Alignment Length:157 Identity:44/157 - (28%)
Similarity:61/157 - (38%) Gaps:29/157 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HG-GHATSYSSVTKHEGPV--------HKSLGYGYDHDVV----------SAYGGIYGHGYPSVG 67
            || |.:..|..||..|.||        |.::.....|.|:          ..:.|:.....|:..
  Fly   660 HGHGLSNGYEGVTNAEEPVTTVEHVVHHPTVATQLHHQVLLPKQQHHHHQQQHHGLVATVLPAEL 724

  Fly    68 HSGYGYG--------YDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKV-KGSYSLKESDG 123
            .|..|..        .||....:..||:|.|.::|.|||:.....:.||...| :|.|.:...||
  Fly   725 DSDKGVNGLHFVNSDEDKSLQQYASKYEFGYRIRDFHTGNDFGHKQNRDLHGVTRGQYHILLPDG 789

  Fly   124 TTRVVEYTADDHNGFNAVVKKLGHAHH 150
            ..:.|.|.||| .||:|.|...|...|
  Fly   790 RIQNVIYHADD-TGFHADVSFEGATKH 815

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 19/52 (37%)
Cpr50CaNP_610899.1 PRK10263 <400..>653 CDD:236669
Chitin_bind_4 751..803 CDD:459790 19/52 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.