DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr49Ah

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_610777.1 Gene:Cpr49Ah / 36354 FlyBaseID:FBgn0033731 Length:190 Species:Drosophila melanogaster


Alignment Length:95 Identity:27/95 - (28%)
Similarity:37/95 - (38%) Gaps:37/95 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YDKHEPHH----------YPKYQFDYGVKDAHTGDQKSQWET------------RDGDK------ 111
            :.:||.|.          |.|.|.|       .|..|:::||            :|.|.      
  Fly    38 HHRHEDHRETSTWIPIIKYNKEQSD-------DGSYKTEYETGNSIIHEETGFLKDFDTNPNGVL 95

  Fly   112 -VKGSYSLKESDGTTRVVEYTADDHNGFNA 140
             ..|.||.:..:||...|:||||: |||.|
  Fly    96 VQHGQYSYQSPEGTLVNVQYTADE-NGFRA 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 19/70 (27%)
Cpr49AhNP_610777.1 Chitin_bind_4 66..122 CDD:459790 16/56 (29%)

Return to query results.
Submit another query.