DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr49Ab

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:101 Identity:29/101 - (28%)
Similarity:41/101 - (40%) Gaps:12/101 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 GHGYPSVGHSGYGYGYDKHEP------HHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSL 118
            |.|   .|..|.|:...:.|.      :|| .::.:.|:....:|..:...| .:|.:.||.|..
  Fly   149 GRG---TGEGGNGWAIIRQEDDVEVDGYHY-LWETENGILGEESGRIEKLTE-EEGLRSKGFYEY 208

  Fly   119 KESDGTTRVVEYTADDHNGFNAVVKKLGHAHHPQVY 154
            ...||....|:|.||| |||......|..|..|..|
  Fly   209 TGPDGILYRVDYVADD-NGFVPSAAHLPTAPPPPPY 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 15/51 (29%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:459790 17/56 (30%)

Return to query results.
Submit another query.