DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr62Ba

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_565358.4 Gene:Cpr62Ba / 3290246 VectorBaseID:AGAMI1_002953 Length:144 Species:Anopheles gambiae


Alignment Length:58 Identity:22/58 - (37%)
Similarity:27/58 - (46%) Gaps:0/58 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 YQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFNAVVK 143
            |.|.|.:....:|.....||.|.||.|.|.|.:.|..|..|.|.|..|..:||..|:|
Mosquito    47 YSFRYYIDHPPSGVSFDHWENRKGDHVHGGYGVLEPGGFVRTVHYEVDGDSGFRTVIK 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 18/51 (35%)
Cpr62BaXP_565358.4 None

Return to query results.
Submit another query.