DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr66D

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_556966.3 Gene:Cpr66D / 3290137 VectorBaseID:AGAMI1_014268 Length:256 Species:Anopheles gambiae


Alignment Length:70 Identity:31/70 - (44%)
Similarity:42/70 - (60%) Gaps:5/70 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGFN 139
            ||.:     |.|||.:.|||....:.:::.|.|||:.:|||||:.:|||..|.|.||||...||.
Mosquito   136 YDAN-----PSYQFGFDVKDDEFTNYQNRKEQRDGNVIKGSYSVVDSDGFIRTVTYTADPKEGFK 195

  Fly   140 AVVKK 144
            |.|.:
Mosquito   196 AEVSR 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 24/51 (47%)
Cpr66DXP_556966.3 Chitin_bind_4 142..194 CDD:459790 24/51 (47%)

Return to query results.
Submit another query.