DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and Cpr57A

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_312200.3 Gene:Cpr57A / 1273241 VectorBaseID:AGAMI1_014812 Length:199 Species:Anopheles gambiae


Alignment Length:66 Identity:26/66 - (39%)
Similarity:32/66 - (48%) Gaps:7/66 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 PK-YQFDY--GVKDAHTGDQKSQWETRDGD-KVKGSYSLKESDGTTRVVEYTADDHNGFNAVVKK 144
            || |.|.|  |....|.  .::..|..||. .|:||:|..:.....|.||||||.| ||..|:..
Mosquito    47 PKPYAFTYSAGRSPGHV--DRTHSEVSDGSGVVRGSFSYVDPRNQVRTVEYTADSH-GFYPVLSH 108

  Fly   145 L 145
            |
Mosquito   109 L 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 20/54 (37%)
Cpr57AXP_312200.3 Chitin_bind_4 50..102 CDD:459790 20/54 (37%)

Return to query results.
Submit another query.