DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Bb and LOC1272964

DIOPT Version :10

Sequence 1:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster
Sequence 2:XP_311895.4 Gene:LOC1272964 / 1272964 VectorBaseID:AGAMI1_008652 Length:200 Species:Anopheles gambiae


Alignment Length:80 Identity:40/80 - (50%)
Similarity:51/80 - (63%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 DKHEPHHYPK--YQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTRVVEYTADDHNGF 138
            |:.|...|.:  |.:.|.|:|..:||.|||.|.|:||:|:|.|...|||||.|:|:|||||..||
Mosquito    79 DRRESSDYDRDDYSYGYAVRDELSGDIKSQQEVRNGDRVRGQYRTLESDGTERIVDYTADDVRGF 143

  Fly   139 NAVVKKLGHAHHPQV 153
            ||||:     |.|.|
Mosquito   144 NAVVR-----HQPSV 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:459790 28/51 (55%)
LOC1272964XP_311895.4 None

Return to query results.
Submit another query.