DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and LOC5667562

DIOPT Version :10

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_001688322.1 Gene:LOC5667562 / 5667562 VectorBaseID:AGAMI1_001759 Length:162 Species:Anopheles gambiae


Alignment Length:80 Identity:35/80 - (43%)
Similarity:48/80 - (60%) Gaps:7/80 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 APVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRI 141
            |||.|..:       ::...:|:|.::|.:.|..|||.|:|.|:|.||.|.|.|::.|.||..|:
Mosquito    44 APVVAKVA-------DDYDPNPQYSYSYHIADALTGDNKEQQESRSGDVVTGSYSLVEPDGTRRV 101

  Fly   142 VEYTADSHNGFQATV 156
            ||||||..|||.|.|
Mosquito   102 VEYTADPVNGFNAVV 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 26/51 (51%)
LOC5667562XP_001688322.1 Chitin_bind_4 60..112 CDD:459790 26/51 (51%)

Return to query results.
Submit another query.