DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR51

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_001688134.1 Gene:CPR51 / 5667292 VectorBaseID:AGAP006844 Length:143 Species:Anopheles gambiae


Alignment Length:128 Identity:58/128 - (45%)
Similarity:70/128 - (54%) Gaps:19/128 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 VAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVE 143
            :.|...:|....|::...||||:|.|||||..|||.|.|||.||||.|||.||:.||||..|:|:
Mosquito    13 IVASAQYHGVPEHKDYHDHPKYKFEYGVKDPHTGDHKTQWEVRDGDVVKGQYTLHEADGTERVVD 77

  Fly   144 YTADSHNGFQATVKHVGHASHLEHS------------------HSYGQQYGHGHGHATSYVDV 188
            |.:|.||||:|.||.||||.|..|.                  |.......||:..| |||:|
Mosquito    78 YKSDGHNGFEADVKKVGHAHHPSHPVHAPVHAPVHHAPAHAPVHVPEHHVHHGYSGA-SYVNV 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 33/51 (65%)
CPR51XP_001688134.1 Chitin_bind_4 34..86 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H123323
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14822
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.