DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR38

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_001688123.1 Gene:CPR38 / 5667275 VectorBaseID:AGAP006857 Length:125 Species:Anopheles gambiae


Alignment Length:99 Identity:58/99 - (58%)
Similarity:66/99 - (66%) Gaps:4/99 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 HEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQAT 155
            ||:...||.|:|.|.|||..|||.|.|||.||||.|||.||:.||||..|:|||::|.||||||.
Mosquito    21 HEDYHSHPSYKFEYCVKDPHTGDHKSQWEHRDGDVVKGQYTLFEADGTKRVVEYSSDKHNGFQAH 85

  Fly   156 VKHVGHASHLE--HSHSYGQQYGHGHGHATSYVD 187
            ||.||||.|.|  ..|..|..|.||||  :||.:
Mosquito    86 VKRVGHAHHPEVYGQHEAGHSYSHGHG--SSYAN 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 33/51 (65%)
CPR38XP_001688123.1 Chitin_bind_4 30..82 CDD:278791 33/51 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H123323
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D67755at7147
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14822
Panther 1 1.100 - - O PTHR12236
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.