DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and CPR109

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:XP_001238124.1 Gene:CPR109 / 4578371 VectorBaseID:AGAP010116 Length:231 Species:Anopheles gambiae


Alignment Length:198 Identity:60/198 - (30%)
Similarity:82/198 - (41%) Gaps:44/198 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ILCCALLGVAAASYIPHGGYSHEHGVGYSIQT--HHEAPKQWQDHHQAHHQWVDVPKAHSWGTVQ 69
            :|...|:..|:|..:|   .:|...:..|..|  ||.||       ...|    |...|:...:.
Mosquito     6 VLLATLVAAASAGLLP---LAHHESIATSHSTIQHHAAP-------AIQH----VGSVHAAPAIY 56

  Fly    70 DHHHQQWAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKE 134
            .|.........|..:..:...|..|.:   |||:|.|.|..|||||.|.|||.||:|.|.|::.:
Mosquito    57 QHSAPAIVKTIAQPTIIKSVEHHAPAN---YEFSYSVHDEHTGDIKSQHETRHGDEVHGQYSLLD 118

  Fly   135 ADGRTRIVEYTADSHNGFQATVK--------------------HVGHASHLEHSHSYGQQYGHGH 179
            :||..|||:|.||.|.||.|.|:                    ||...:|...:|:..|     |
Mosquito   119 SDGHQRIVDYHADHHTGFNAVVRREPSAVKIAQPVHKVIAQPVHVSSYAHAPVAHATVQ-----H 178

  Fly   180 GHA 182
            .||
Mosquito   179 HHA 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 29/51 (57%)
CPR109XP_001238124.1 Chitin_bind_4 84..136 CDD:278791 29/51 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.