powered by:
Protein Alignment Cpr76Ba and AgaP_AGAP012795
DIOPT Version :9
Sequence 1: | NP_649120.1 |
Gene: | Cpr76Ba / 40120 |
FlyBaseID: | FBgn0036878 |
Length: | 204 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_001230390.1 |
Gene: | AgaP_AGAP012795 / 4397822 |
VectorBaseID: | AGAP012795 |
Length: | 86 |
Species: | Anopheles gambiae |
Alignment Length: | 40 |
Identity: | 23/40 - (57%) |
Similarity: | 27/40 - (67%) |
Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 QWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATV 156
|.|:|.||.|.|.|::.|.||..|:||||||..|||.|.|
Mosquito 1 QQESRSGDVVTGSYSLVEPDGTRRVVEYTADPVNGFNAVV 40
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C9WU |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.