DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:66 Identity:35/66 - (53%)
Similarity:45/66 - (68%) Gaps:0/66 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 EEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTRIVEYTADSHNGFQATV 156
            ||...||:|.::|.|:||.:||.|...|.||||.|:|.|::.:|||..|.|.|||||.|||.|.|
  Fly    43 EEVDPHPQYTYSYDVQDTLSGDNKGHVEERDGDVVRGEYSLIDADGFKRTVTYTADSINGFNAVV 107

  Fly   157 K 157
            :
  Fly   108 R 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:459790 27/51 (53%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 27/51 (53%)

Return to query results.
Submit another query.