DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr76Ba and Cpr76Bb

DIOPT Version :9

Sequence 1:NP_649120.1 Gene:Cpr76Ba / 40120 FlyBaseID:FBgn0036878 Length:204 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:200 Identity:89/200 - (44%)
Similarity:108/200 - (54%) Gaps:34/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ALLGVAAASYIPHGGYSHEHGVGYSIQTHHEAPKQWQDHHQAHHQWVDVPKAHSWGTVQDHHHQQ 75
            ||| |.|:...||||    |...||..|.||.|.     |::.....|.....::|.:..|.:  
  Fly    11 ALL-VGASWAAPHGG----HATSYSSVTKHEGPV-----HKSLGYGYDHDVVSAYGGIYGHGY-- 63

  Fly    76 WAPVAAHDSHHQWSHHEEPKHHPKYEFNYGVKDTKTGDIKQQWETRDGDKVKGGYTMKEADGRTR 140
              |...|..:.......||.|:|||:|:|||||..|||.|.||||||||||||.|::||:||.||
  Fly    64 --PSVGHSGYGYGYDKHEPHHYPKYQFDYGVKDAHTGDQKSQWETRDGDKVKGSYSLKESDGTTR 126

  Fly   141 IVEYTADSHNGFQATVKHVGHASHLE-------HSHSYGQQYGHGH-------------GHATSY 185
            :||||||.||||.|.||.:|||.|.:       |...|...||:||             |||:||
  Fly   127 VVEYTADDHNGFNAVVKKLGHAHHPQVYHKGYGHGDIYDADYGYGHDVAQYGGYGYGHGGHASSY 191

  Fly   186 VDVKQ 190
            |.|||
  Fly   192 VSVKQ 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr76BaNP_649120.1 Chitin_bind_4 100..152 CDD:278791 38/51 (75%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 38/51 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C9WU
Homologene 1 1.000 - - H123323
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D154170at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm14822
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.